Generic selectors
Exact matches only
Search in title
Search in content
Post Type Selectors
Search in posts
Search in pages
Filter by Categories
Addendum
Announcement
Announcements
Author’ response
Author’s reply
Authors' response
Authors#x2019; response
Book Received
Book Review
Book Reviews
Books Received
Centenary Review Article
Clinical Image
Clinical Images
Commentary
Communicable Diseases - Original Articles
Correspondence
Correspondence, Letter to Editor
Correspondences
Correspondences & Authors’ Responses
Corrigendum
Corrrespondence
Critique
Current Issue
Editorial
Editorial Podcast
Errata
Erratum
FORM IV
GUIDELINES
Health Technology Innovation
IAA CONSENSUS DOCUMENT
Innovations
Letter to Editor
Malnutrition & Other Health Issues - Original Articles
Media & News
Notice of Retraction
Obituary
Original Article
Original Articles
Panel of Reviewers (2006)
Panel of Reviewers (2007)
Panel of Reviewers (2009) Guidelines for Contributors
Perspective
Policy
Policy Document
Policy Guidelines
Policy, Review Article
Policy: Correspondence
Policy: Editorial
Policy: Mapping Review
Policy: Original Article
Policy: Perspective
Policy: Process Paper
Policy: Scoping Review
Policy: Special Report
Policy: Systematic Review
Policy: Viewpoint
Practice
Practice: Authors’ response
Practice: Book Review
Practice: Clinical Image
Practice: Commentary
Practice: Correspondence
Practice: Letter to Editor
Practice: Method
Practice: Obituary
Practice: Original Article
Practice: Pages From History of Medicine
Practice: Perspective
Practice: Review Article
Practice: Short Note
Practice: Short Paper
Practice: Special Report
Practice: Student IJMR
Practice: Systematic Review
Pratice, Original Article
Pratice, Review Article
Pratice, Short Paper
Programme
Programme, Correspondence, Letter to Editor
Programme: Authors’ response
Programme: Commentary
Programme: Correspondence
Programme: Editorial
Programme: Original Article
Programme: Originial Article
Programme: Perspective
Programme: Rapid Review
Programme: Review Article
Programme: Short Paper
Programme: Special Report
Programme: Status Paper
Programme: Systematic Review
Programme: Viewpoint
Protocol
Public Notice
Research Brief
Research Correspondence
Retraction
Review Article
Reviewers
Short Paper
Some Forthcoming Scientific Events
Special Article
Special Opinion Paper
Special Report
Special Section Nutrition & Food Security
Status Paper
Status Report
Strategy
Student IJMR
Systematic Article
Systematic Review
Systematic Review & Meta-Analysis
View Point
Viewpoint
White Paper
Generic selectors
Exact matches only
Search in title
Search in content
Post Type Selectors
Search in posts
Search in pages
Filter by Categories
Addendum
Announcement
Announcements
Author’ response
Author’s reply
Authors' response
Authors#x2019; response
Book Received
Book Review
Book Reviews
Books Received
Centenary Review Article
Clinical Image
Clinical Images
Commentary
Communicable Diseases - Original Articles
Correspondence
Correspondence, Letter to Editor
Correspondences
Correspondences & Authors’ Responses
Corrigendum
Corrrespondence
Critique
Current Issue
Editorial
Editorial Podcast
Errata
Erratum
FORM IV
GUIDELINES
Health Technology Innovation
IAA CONSENSUS DOCUMENT
Innovations
Letter to Editor
Malnutrition & Other Health Issues - Original Articles
Media & News
Notice of Retraction
Obituary
Original Article
Original Articles
Panel of Reviewers (2006)
Panel of Reviewers (2007)
Panel of Reviewers (2009) Guidelines for Contributors
Perspective
Policy
Policy Document
Policy Guidelines
Policy, Review Article
Policy: Correspondence
Policy: Editorial
Policy: Mapping Review
Policy: Original Article
Policy: Perspective
Policy: Process Paper
Policy: Scoping Review
Policy: Special Report
Policy: Systematic Review
Policy: Viewpoint
Practice
Practice: Authors’ response
Practice: Book Review
Practice: Clinical Image
Practice: Commentary
Practice: Correspondence
Practice: Letter to Editor
Practice: Method
Practice: Obituary
Practice: Original Article
Practice: Pages From History of Medicine
Practice: Perspective
Practice: Review Article
Practice: Short Note
Practice: Short Paper
Practice: Special Report
Practice: Student IJMR
Practice: Systematic Review
Pratice, Original Article
Pratice, Review Article
Pratice, Short Paper
Programme
Programme, Correspondence, Letter to Editor
Programme: Authors’ response
Programme: Commentary
Programme: Correspondence
Programme: Editorial
Programme: Original Article
Programme: Originial Article
Programme: Perspective
Programme: Rapid Review
Programme: Review Article
Programme: Short Paper
Programme: Special Report
Programme: Status Paper
Programme: Systematic Review
Programme: Viewpoint
Protocol
Public Notice
Research Brief
Research Correspondence
Retraction
Review Article
Reviewers
Short Paper
Some Forthcoming Scientific Events
Special Article
Special Opinion Paper
Special Report
Special Section Nutrition & Food Security
Status Paper
Status Report
Strategy
Student IJMR
Systematic Article
Systematic Review
Systematic Review & Meta-Analysis
View Point
Viewpoint
White Paper
View/Download PDF

Translate this page into:

Original Article
163 (
3
); 282-289
doi:
10.25259/IJMR_2990_2025

Evolutionary analysis and immunoinformatic-based epitope prediction of dengue virus serotype 2 strains from Sri Lanka

Genetics and Molecular Biology Unit, Faculty of Applied Sciences, University of Sri Jayewardenepura, Nugegoda, Sri Lanka

For correspondence: Dr Pavithra Dilakshini Dayananda, Genetics and Molecular Biology Unit, Faculty of Applied Sciences, University of Sri Jayewardenepura, Nugegoda 10250, Sri Lanka e-mail: dilakshini@sci.sjp.ac.lk

Licence
This is an open-access article distributed under the terms of the Creative Commons Attribution-Non Commercial-Share Alike 4.0 License, which allows others to remix, transform, and build upon the work non-commercially, as long as the author is credited and the new creations are licensed under the identical terms.

How to cite this article: Gunawardane DS, Navarathna A, Kulasinghe PA, Jayakanth TC, Daynanda PD. Evolutionary analysis and immunoinformatic-based epitope prediction of dengue virus serotype 2 strains from Sri Lanka. Indian J Med Res. 2026;163:282-9. doi: 10.25259/IJMR_2990_2025.

Abstract

Background and objectives

To investigate the phylogenetic and evolutionary relationships of dengue virus 2 (DENV-2) strains in Sri Lanka and identify probable antigenic B and T cell epitopes in the envelope gene region.

Methods

Phylogenetic analysis was conducted on the envelope gene region of Sri Lankan DENV-2 strains alongside globally homologous sequences. Selection pressure analysis identified codons under diversifying and purifying selection. Epitope prediction was performed to detect probable antigenic B and T cell epitopes.

Results

The sequences belonged to two major lineages of the cosmopolitan genotype: major lineage A and F from various geographical regions. Phylogenetic analysis showed segregation into distinct clades, with close sub-clustering of Sri Lankan strains with those from China, Malaysia, Myanmar, Taiwan, and Reunion Island. Selection pressure analysis revealed two sites under diversifying selection, with numerous sites under purifying selection. Epitope prediction detected several linear B and T cell epitopes with probable antigenicity within the envelope gene region.

Interpretation and conclusions

This study highlights the widespread dominance of the cosmopolitan genotype in Sri Lanka and underscores the role of air travel and human migration in viral transmission and global strain introduction. The presence of diversifying selection at two E gene sites alongside widespread purifying selection suggests evolutionary pressures on viral fitness. The identified B and T cell epitopes represent potential targets for universal vaccine development and therapeutic interventions.

Keywords

Cosmopolitan genotype
Dengue virus serotype 2
Epitope prediction
Phylogenetic analysis
Selection pressure

Dengue virus (DENV) is a positive-sense, single-stranded RNA virus belonging to the genus Flavivirus (family Flaviviridae)1,2 comprising four antigenically distinct yet genetically related serotypes (DENV 1-4).1,3 Each serotype exhibits phylogenetic diversity and is classified into multiple genotypes based on geographic distribution and genetic variation. The major genotypes include Asian I, Asian II, Cosmopolitan, American, Southeast Asian/American, and Sylvatic genotypes.3,4

Dengue epidemiology in Sri Lanka is complex, with severe disease outcomes influenced by ecological and human factors. All four DENV serotypes have co-circulated in Sri Lanka for more than 30 years,5,6 with DENV-2 playing a major role in severe outbreaks occurring every five to six years.7,8 The 2017 outbreak was predominantly driven by DENV-2, which is phylogenetically divided into two major lineages: one circulating before 2004 and another emerging after 2016.

Given the lack of specific treatment methods and limited phylogenetic studies on DENV-2 in Sri Lanka, this study was designed to investigate the phylogenetic and evolutionary relationships of DENV-2 strains in Sri Lanka and to determine their possible dissemination routes. This study further extends the detection of probable antigenic B and T cell epitopes, which could help in the development of effective peptide vaccines and therapeutic strategies in the future.

Methods

This Bioinformatics Study was undertaken by the Genetics and Molecular Biology Unit of the University of Sri Jayewardenepura, Sri Lanka.

Phylogenetic analysis

DENV-2 sequences from Sri Lanka (2003-2022) and their homologous global sequences (2001-2023) were obtained from the National Center for Biotechnology Information (NCBI) public database. A complete dataset of 71 sequences was created using both the Sri Lankan and homologous global sequences. The genotypes of the collected sequences were determined using a dengue genotyping tool named Genome Detective (https://www.genomedetective.com/app/typingtool/dengue/).

Bayesian phylogenetic trees were generated using MrBayes-3.2.5_WIN_x64:BI software, excluding the recombinant sequences. Two phylogenetic trees were generated using separate data sets; one that included Sri Lankan and global homologous sequences along with the reference sequence (AF038403), containing both complete and partial sequences encoding the envelope gene region; and the other that included Sri Lankan and global homologous sequences encoding only the complete envelope gene region. The Yellow Fever virus was used as the outgroup (NC 002031). The generated phylogenetic trees were visualised and edited using the FigTree v1.4.4 software.

Selection pressure analysis

Selection pressure analysis was conducted using three maximum likelihood (ML) based methods available in the data monkey adaptive evolution server (https://www.datamonkey.org/), namely, fixed effect likelihood (FEL), single likelihood ancestor counting (SLAC), and mixed-effects model of evolution (MEME).9

Epitope prediction

B cell epitope prediction

Two distinct tools were used to predict the linear B cell epitopes, B cell epitope prediction server (BCPreds) (http://ailab-projects2.ist.psu.edu/bcpred/predict.html),10 and the Bepipred Linear Epitope Prediction 2.0 tool of the immune epitope database (IEDB) analysis resource (https://www.iedb.org/).11 For the BCPreds analysis, the open reading frame (ORF) sequences were subjected to B cell epitope prediction and all the 20-mer linear B cell epitopes with a score greater than 0.8 were selected12 and for the B cell epitope prediction using the Bepipred Linear Epitope Prediction 2.0 tool of the immune epitope database (IEDB) analysis resource, all the predicted linear B cell epitopes of length greater than five were selected. These selected B-cell epitopes were further analysed for antigenicity using the VaxiJen server, and the antigenicity score for each epitope was recorded. The threshold was considered as 0.4.13

T cell epitope prediction

T cell epitopes were predicted using prediction tools of the IEDB analysis resource, and those with binding affinities to major histocompatibility complex (MHC) class I and class II molecules were separately predicted.

The NetMHCpan 4.1 BA prediction method was used to detect MHC class I binding T cell epitopes of all lengths14 against the human MHC class I alleles, HLA-A*24.02 and HLA-A*31.01.15 All epitopes with an IC50 value less than or equal to 849 were selected.

The NetMHCIIpan 4.1 BA prediction method was used to detect MHC class II binding 15-mer T cell epitopes, against the human MHC class II alleles, HLA-DRB1*07:01, HLA-DRB1*08:02, HLA-DRB1*08:03, and HLA-DRB1*12:02.15,16 All epitopes with a percentile rank less than or equal to 10% were selected.

The predicted T cell epitopes were analysed for antigenicity using the VaxiJen server, and the scores were recorded.

Results

Phylogenetic analysis

Both phylogenetic trees (Figs. 1 and 2) displayed strain segregation into two major lineages of the cosmopolitan genotype: major lineage F (2II_F, denoted in red), containing Sri Lankan sequences from 2016-2022, and major lineage A (2II_A, denoted in green), containing Sri Lankan sequences from 2003 and 2004. A clear geographical clustering of sequences from the same country or neighbouring countries was observed in both phylogenetic trees, and both trees followed similar topology with moderate to strong support values.

Calibrated maximum-clade-credibility tree for DENV-2 using both partial and complete envelope gene sequences. The GTR model was used for this 1500 base pair dataset of the envelope gene fragment. The numbers above each branch represent the posterior probability (PP) values obtained in the Bayesian Index (1.00). Yellow fever virus was used as the outgroup.
Fig.1.
Calibrated maximum-clade-credibility tree for DENV-2 using both partial and complete envelope gene sequences. The GTR model was used for this 1500 base pair dataset of the envelope gene fragment. The numbers above each branch represent the posterior probability (PP) values obtained in the Bayesian Index (1.00). Yellow fever virus was used as the outgroup.
Calibrated maximum-clade-credibility tree for DENV-2 using complete envelope gene sequences. The GTR model was used for this 1500 base pair dataset of the envelope gene fragment. The numbers above each branch represent the posterior probability (PP) values obtained in the Bayesian Index (1.00). Yellow fever virus was used as the outgroup.
Fig. 2.
Calibrated maximum-clade-credibility tree for DENV-2 using complete envelope gene sequences. The GTR model was used for this 1500 base pair dataset of the envelope gene fragment. The numbers above each branch represent the posterior probability (PP) values obtained in the Bayesian Index (1.00). Yellow fever virus was used as the outgroup.

A clear segregation of all 2II_A DENV-2 strains into two distinct clades were observed in phylogenetic tree I, illustrating strong and moderate support (PP 0.78 and 0.62) for each of the clades respectively (Fig. 1), while the segregation of all 2II_A DENV-2 strains into a single clade (PP 0.63), illustrating moderate support for the clade, was visible in phylogenetic tree II (Fig. 2).

Clustering of the Sri Lankan strains from 2003 and 2004 (FJ502920 and FJ502914) with a Chinese strain from 2023 (OR418375) and two Indian strains from 2001 and 2013 (DQ448237 and KP940439) was visible in phylogenetic tree I (Fig. 1). Further, sub clustering of a Sri Lankan strain (KX778743) with isolates from Pakistan from the years 2009 and 2011 (KF041230, KP757138, JX042510) was observed in phylogenetic tree I (PP 0.78), illustrating a strong support for the sub clade. Since the Sri Lankan strains of the major lineage A were partial sequences coding for the envelope gene region, none of the above Sri Lankan strains were included in phylogenetic tree II (Fig. 2).

The distinct clustering of 2II_F strains into a single clade was clearly observed in both phylogenetic trees with a moderate support (PP 0.63) and a strong support (PP 0.7), respectively. The clade included the reported strains of DENV-2 from countries of the Southeast Asian Region, the Western Pacific Region, the Eastern Mediterranean Region, and the Reunion Island, including the Sri Lankan strains from 2016-2022. Further sub-clustering of DENV-2 strains with a strong to moderate support was also visible within this major clade in both trees.

The sub clustering of Sri Lankan strains reported in 2016 and 2017 (KY495803 and MZ520913, respectively) with the strains reported from China in 2015 (MG737964), 2016 (ON911798) and 2017 (MG840627, MW365262 and MH827551), Myanmar in 2016 (MW332627), and Taiwan in 2016 (MG895144) were observed in both trees with a strong support value (PP 0.78). Further sub-clustering of Sri Lankan strains (KY495803 and MZ520913) reported in 2016 and 2017, with two Chinese isolates from 2017 (MG840627 and MW365262) and the Myanmar isolate from 2016 (MW332627), were clearly visible in both trees with strong support values of PP 0.97 and PP 0.98, respectively.

The 2017 Sri Lankan isolates displayed distinct sub-clustering patterns in both phylogenetic trees. Specifically, isolate MT006167 clustered with a 2017 Reunion Island isolate (OR236093; PP 0.74 in Fig. 1, PP 0.75 in Fig. 2), while LC312197 clustered with a 2017 Chinese isolate (MH827548; PP 0.64 in Fig. 1, PP 0.70 in Fig. 2). Isolate MN577549 grouped with a 2018 Malaysian strain (PP124252; PP 0.94 in both figures), and MN602605 clustered with sequences from the East Asian and Western Pacific regions (PP 0.69 in Fig. 1, PP 0.64 in Fig. 2).

Furthermore, sub-clustering of Sri Lankan strains reported in 2018 and 2022 (MT006186 and OQ102952, respectively) with a 2023 Chinese isolate (PP564550) was observed in both trees (PP 0.65 and 0.85, respectively). Sub clustering of Sri Lankan strains reported in 2019 (PP434968, PP234965) and 2020 (OR394053) with a Chinese strain reported in 2019 (OP684213) was also evident, with a PP value of 0.98.

Selection pressure inference

The fixed effects likelihood (FEL) method detected 98 sites of the envelope gene region that were under purifying selection (P<0.1), and no sites under episodic positive/diversifying selection were detected through this method. Similarly, the single-likelihood ancestor counting (SLAC) method detected 43 sites of the envelope gene region of the strains included in the ORF dataset to be under purifying selection (P<0.1), and no sites under episodic positive/diversifying selection were detected through this method. Two sites of the envelope gene region, sites 159 and 182, were detected to be under episodic diversifying selection by the MEME method from the ORF dataset analysed.

Epitope prediction

B cell epitope prediction

B cell epitopes predicted by the B Cell epitope prediction server (BCPreds) and the immune epitope database (IEDB) analysis resource are presented in the Table.

Table. Predicted B cell epitopes with probable antigenicity using IEDB and BCPreds, their lengths, BCPreds scores (where applicable) and antigenicity scores
B cell epitopes (BCPreds) Length (amino acids) BCPreds score Antigenicity score
VEPGQLKLSWFKKGSSIGQM 20 0.999 1.0872
KLTNTTTASRCPTQGEPSLN 20 0.999 0.8825
PLPWLPGADTQGSNWIQKET 20 0.994 0.5089
TVNPIVTEKDSPVNIEAEPP 20 0.987 0.9435
HGTIVIRVQYEGDGSPCKIP 20 0.978 0.5904
EENAVGNDTGKHGKEIKVTP 20 0.938 0.7138
MVDRGWGNGCGLFGKGGIVT 20 0.914 0.6272
LTGYGTVTMECSPRTGLDFN 20 0.869 1.0102
FTCKKNMEGKIVQPENLEYT 20 0.85 0.8238
KNPHAKKQDVVVLGSQEGAM 20 0.813 0.6078
B cell epitope (IEDB)
EIKMSSG 7 - 0.7222
WDFGSLGG 8 - 2.1175
FEIMDLEKRH 10 - 2.07
QLKLSWFKKGSS 12 - 0.8835
FLDLPLPWLPGADTQGSNWIQKE 23 - 0.4451
TTASRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGN 35 - 0.5141

T cell epitope prediction

MHC class I binding T cell epitopes predicted against the HLA-A*24.02 allele and the HLA-A*31.01 allele are presented in Supplementary Table I.

Supplementary Table I

MHC Class II binding T cell epitopes predicted against the alleles HLA-DRB1*07:01, HLA-DRB1*08:02, HLA-DRB1*08:03, and HLA-DRB1*12:02 are presented in Supplementary Table II.

Supplementary Table II

Discussion

This study characterised the phylogenetic and evolutionary dynamics of DENV-2 strains circulating in Sri Lanka from 2003 to 2022. Phylogenetic analyses revealed that all Sri Lankan isolates clustered within the cosmopolitan genotype, segregating into two major lineages: lineage A (2II_A) for strains from 2003-2004 and lineage F (2II_F) for strains from 2016 onward, suggesting a lineage shift around late 2016. The 2017 outbreak strains showed close phylogenetic relationships with Southeast Asian isolates from 2014-2016 and significant clustering with Chinese strains, indicating sustained regional viral transmission. Notable phylogenetic associations with isolates from Reunion Island (2017) and Malaysia (2018) indicate active viral gene flow across geographically diverse regions. Selection pressure analysis identified predominantly purifying selection across the envelope gene, with two novel positively selected codon sites (159 and 182). Epitope prediction revealed that several positively selected sites, including the novel site 159, encoded B-cell and T-cell epitopes with high probable antigenicity, suggesting critical roles in immune evasion and viral adaptation.

The findings are consistent with and extend previous research on DENV-2 evolution and transmission dynamics. The co-circulation of all DENV serotypes in Sri Lanka5,6 has established DENV-2 as a significant contributor to dengue-associated morbidity and mortality. The persistent dominance of the cosmopolitan genotype is consistent with global phylogenetic studies,17-21 with its widespread distribution across WHO’s Southeast Asian, Western Pacific, and Eastern Mediterranean Region, reflecting the virus’s remarkable adaptive capacity across different environmental contexts.

The observed lineage shift in 201622 corroborates with independent investigations23 showing that 2017 Sri Lankan isolates form a distinct clade separate from 1985 – 2004 isolates, reinforcing the hypothesis that this transition contributed to outbreak severity. Following the emergence and dominance of DENV-1 from 2009 to mid-2016,8,24 the DENV-2 reintroduction in 2016 marked a major serotype shift with profound implications for population-level immunity dynamics. The 2017 outbreak resulted in 186,101 suspected cases and 440 deaths, with DENV-2 as the predominant serotype.8,23,25 Phylogenetic sub-clustering of 2017 isolates with Southeast Asian strains from 2014-2016 suggests introduction of multiple DENV-2 variants.19 The quasi-species nature of the virus,26 shaped by diverse evolutionary mechanisms, likely facilitated the emergence of multiple viral strains across different regions. Consequently, the concurrent circulation of multiple DENV-2 strains, combined with the serotype shift and a potential lineage transition, may have created conditions conducive to antibody-dependent enhancement-mediated disease severity,27 contributing significantly to the 2017 outbreak magnitude.

The close phylogenetic clustering of Sri Lankan DENV-2 strains with Chinese isolates, correlates with a documented 72.5% increase in Chinese tourist arrivals to Sri Lanka during 2010-2016,28 positioning China as the third-largest tourist source to the country. The intensification of bilateral tourism likely facilitated viral transmission, providing phylogenetic evidence for the role of international travel in dengue dissemination. The identification of imported DENV cases in Reunion Island in 2017, including sequences from Sri Lanka29,30 supports an indirect epidemiological link between the 2017 Sri Lankan outbreak and the 2018 Reunion Island outbreak. These transmission patterns represent active viral gene flow facilitated by Sri Lanka’s strategic geographical position at the crossroads of major Indian Ocean sea routes and the expanding international air travel.19,31 The clustering of 2017 Sri Lankan strains with strains from major aviation hubs (Singapore, Malaysia, India, China, and Taiwan) from 2013-2016 suggests that air travel and human migration have been pivotal in transmitting viral strains from Southeast Asian and Western Pacific regions. Additional transmission routes may include inadvertent transport of infected mosquito eggs and larvae through international trade and the silent transmission via asymptomatic carriers.32,33

The predominance of purifying selection in the envelope gene aligns with previous evolutionary studies,19,34,35 reporting the conserved nature of DENV-2 structural proteins.34 However, this study advances the field by identifying two novel positively selected sites (159 and 182) not previously documented. The identification of epitope-bearing codons under positive selection extends previous immunological studies by directly linking evolutionary pressures to functional antigenic regions. The envelope protein plays a critical role in mediating viral attachment and host cell entry and serves as a major target for neutralising antibodies.36 Therefore, the positioning of positively selected codons within this region may facilitate immune evasion, suggesting natural selection to ensure viral survival. Identifying these epitope-bearing codons provides functional insight into the evolutionary patterns in circulating DENV-2 strains, as sites under positive selection that overlap with immunogenic regions are likely shaped by antibody or T-cell-mediated immune responses. This work provides novel insights for rational vaccine design strategies and establishes a foundation for future peptide-based vaccines or therapeutic strategies against DENV infections.

This study provides a comprehensive phylogenetic analysis of Sri Lankan DENV-2 strains spanning two decades, offering valuable insights into viral evolution, lineage dynamics, and international transmission patterns. However, several limitations warrant consideration. The relatively small dataset may have limited the detection of additional positively selected sites, and incomplete temporal representation may not fully capture viral evolution dynamics. Additionally, phylogenetic inferences regarding transmission routes remain correlative and require experimental validation. Future studies incorporating larger sample sizes, whole-genome sequencing, and functional assays would provide more robust insights into evolutionary mechanisms driving DENV-2 circulation in Sri Lanka.

The findings underscore the need for enhanced genomic surveillance systems in Sri Lanka to track viral evolution in real time. Given the strong correlation between international travel and viral transmission, targeted vector control at ports of entry and strengthened surveillance of travellers from endemic regions should be prioritised. The novel positively selected epitopes identified, particularly at codon site 159, provide valuable targets for developing region-specific diagnostics and vaccine candidates. The documented association between serotype shifts and severe outbreaks highlights the importance of maintaining robust serotype-specific surveillance. Regional collaboration for data sharing across affected countries remains essential for early outbreak detection and effective dengue control.

Author contributions

PDD: Conceptualisation, design, and definition of intellectual content; DSG: Literature search; DSG, DSG, PAK, TCJ: Data acquisition; DSG, AN, PAK, TCJ: Data analysis; DSG: Manuscript writing; DSG, AN: PDD: Manuscript writing. All the authors have read and approved the final printed version of the manuscript.

Financial support and sponsorship

None.

Conflicts of Interest

None.

Use of Artificial Intelligence (AI)-Assisted Technology for manuscript preparation

The authors confirm that there was no use of AI-assisted technology for assisting in the writing of the manuscript and no images were manipulated using AI.

References

  1. . Dengue and dengue hemorrhagic fever. Clin Microbiol Rev.. 1998;11:480-96.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  2. , . Dengue. Lancet.. 2015;385:453-65.
    [CrossRef] [PubMed] [Google Scholar]
  3. , . Dengue— Quo tu et quo vadis? Viruses. 2011;3:1562-608.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  4. . Microevolution and virulence of dengue viruses. Adv Virus Res.. 2003;59:315-41.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  5. , . Evolution of dengue in Sri Lanka— Changes in the virus, vector, and climate. Int J Infect Dis.. 2014;19:6-12.
    [CrossRef] [PubMed] [Google Scholar]
  6. , , , , , , et al. Circulating dengue virus serotypes and vertical transmission in Aedes larvae during outbreak and inter-outbreak seasons in a high dengue risk area of Sri Lanka. Parasites Vectors.. 2021;14:614.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  7. , , , , , , et al. Evaluation of the traditional and revised WHO classifications of dengue disease severity. PLoS Negl Trop Dis.. 2011;5:e1397.
    [CrossRef] [PubMed] [Google Scholar]
  8. , , , , , , et al. Emergence of a dengue virus serotype 2 causing the largest ever dengue epidemic in Sri Lanka. bioRxiv [Preprint] 2018
    [Google Scholar]
  9. , , , , , . Datamonkey 2.0: A modern web application for characterizing selective and other evolutionary processes. Mol Biol Evol.. 2018;35:773-7.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  10. , , . Predicting linear B-cell epitopes using string kernels. J Mol Recognit.. 2008;21:243-55.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  11. , , , . BepiPred-2.0: Improving sequence-based B-cell epitope prediction using conformational epitopes. Nucleic Acids Res.. 2017;45:W24-9.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  12. , , , . In silico prediction of monovalent and chimeric tetravalent vaccines for prevention and treatment of dengue fever. J Biomed. 2017;32:222-36.
    [PubMed] [Google Scholar]
  13. , . VaxiJen: A server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinformatics.. 2007;8:4.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  14. , , , , , . Immunoinformatic approach to design T cell epitope-based chimeric vaccine targeting multiple serotypes of dengue virus. J Biomol Struct Dyn.. 2026;44:1706-24.
    [CrossRef] [PubMed] [Google Scholar]
  15. , , , , , , et al. HLA class I and class II associations in dengue viral infections in a Sri Lankan population. PLoS One.. 2011;6:e20581.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  16. , , , , , , et al. HLA-DRB1 alleles are associated with different magnitudes of dengue virus–specific CD4+ T-cell responses. J Infect Dis.. 2016;214:1117-24.
    [PubMed] [Google Scholar]
  17. , , , . Dengue transmission in the Asia-Pacific region: Impact of climate change and socio-environmental factors. Trop Med Int Health.. 2011;16:598-607.
    [CrossRef] [PubMed] [Google Scholar]
  18. , . The complete genome phylogeny of geographically distinct dengue virus serotype 2 isolates (1944-2013) supports further groupings within the cosmopolitan genotype. PLoS. 2015;10:e0138900.
    [CrossRef] [Google Scholar]
  19. , , , , , , et al. Evolution, heterogeneity and global dispersal of the cosmopolitan genotype of dengue virus type 2. Sci Rep.. 2021;11:13496.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  20. , , , , , , et al. Emergence of dengue virus serotype 2 cosmopolitan genotype, Brazil. Emerg Infect Dis.. 2022;28:1725-7.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  21. , , , , , , et al. Multiple introductions and country-wide spread of DENV-2 genotype II (Cosmopolitan) in Brazil. Virus Evol.. 2023;9:vead059.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  22. , , , , , , et al. A new lineage nomenclature to aid genomic surveillance of dengue virus. PLoS Biol.. 2024;22:e3002834.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  23. , , , , , , et al. Unusual, neurological and severe dengue manifestations during the outbreak in Sri Lanka, 2017. J Clin Virol.. 2020;125:104304.
    [CrossRef] [PubMed] [Google Scholar]
  24. , , , , , , et al. Evaluation of the WHO revised criteria for classification of clinical disease severity in acute adult dengue infection. BMC Res Notes.. 2012;5:645.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  25. , , , , , . The unprecedented magnitude of the 2017 dengue outbreak in Sri Lanka provides lessons for future mosquito-borne infection control and prevention. Infect Dis Health.. 2018;23:114-20.
    [CrossRef] [PubMed] [Google Scholar]
  26. . Quasispecies of dengue virus. Trop Med Health.. 2011;39:29-36.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  27. , , , , , , et al. Dengue virus infection-Enhancing antibody activities against Indonesian strains in inhabitants of Central Thailand.Microbes Infect. 2016. ;18:277-84.
    [Google Scholar]
  28. , , . Sri Lanka–China tourism relations: Analysis of recent trends in Chinese tourist arrivals to Sri Lanka. Sri Lanka J Adv Soc Stud.. 2019;9:49.
    [Google Scholar]
  29. , , , , , , et al. Epidemic of dengue virus type-2 cosmopolitan genotype on Réunion Island relates to its active circulation in Southwestern Indian Ocean Islands. Heliyon.. 2019;5:e01455.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  30. , , , , , , et al. Dynamics of emergence and genetic diversity of dengue virus in Reunion Island from 2012 to 2022. PLoS Negl Trop Dis.. 2024;18:e0012184.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  31. , , , , . Entomological surveillance with viral tracking demonstrates a migrated viral strain causing the dengue epidemic in July 2017 in Sri Lanka. PLoS One.. 2020;15:e0231408.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
  32. , , , , , , et al. Early detection of dengue infections using cluster sampling around index cases. Am J Trop Med Hyg.. 2005;72:777-82.
    [CrossRef] [PubMed] [Google Scholar]
  33. , , . Asymptomatic dengue and silent transmission. In: , ed. Dengue fever in a one health perspective - Latest research and recent advances. IntechOpen; .
    [Google Scholar]
  34. , , , , , , et al. Phylogenetic relationships and differential selection pressures among genotypes of dengue-2 virus. Virology.. 2002;298:63-72.
    [CrossRef] [PubMed] [Google Scholar]
  35. , , . Circulation of different lineages of dengue virus type 2 in Central America, their evolutionary time-scale and selection pressure analysis. PLoS. 2011;6:e27459.
    [Google Scholar]
  36. . Dengue virus envelope glycoprotein structure: New insight into its interactions during viral entry. Proc Natl Acad Sci U S A.. 2003;100:6899-901.
    [CrossRef] [PubMed] [PubMed Central] [Google Scholar]
Show Sections
Scroll to Top